home Article What branches can you give a chinchilla to gnaw

What branches can you give a chinchilla to gnaw

Recommendations for preparing feed from branches

Shoots and twigs of various plants are introduced into the diet of animals for several reasons:

  • Wood diversifies the diet of a pet, deprived of the opportunity to choose what it needs at the moment, as it does in its natural habitat. Greens and twigs are rich in vitamins, minerals, trace elements. This is a good addition to the daily diet of the animal.
  • Chinchilla teeth, like other rodents, grow continuously. They need to be grinded. For this reason, the animal is constantly gnawing something. Solid wood is perfect for this. Otherwise, the chinchilla will begin to gnaw everything that is available to her, and this does not always please the owners.
  • Any wooden objects are perceived by animals as toys. You can entertain your pet with twig and twig games. So communication with him will become more diverse, and he himself will become sociable, active, full of trust in you.

Dried young shoots are a natural product similar in nutritional value to hay. It contains proteins, fats, and also a lot of fiber. In industry, vitamin flour is produced from such raw materials.

Branches are harvested during the growing season of plants, when they have the most nutrients.

The places where branches are cut should be environmentally friendly. Forests are unsuitable for harvesting if there are highways or industrial zones nearby. It is also not worth storing wood fodder within the city, even in parks.

The twigs must be clean. free of mold, pests, fungal infections and animal bites.

The bark contains nutrients in maximum concentration, so it does not need to be cleaned.

branches, give, chinchilla, gnaw

Rules for self-harvesting branches

When buds appear on the trees, you can start harvesting branches. They are cut with pruning shears. The sap moving through the trees at this time has the most valuable nutritional composition.

  • Only live branches are taken from healthy trees and shrubs. Dried, dirty, moldy and tooth-stained animals cannot be cut off. The stalks of raspberries, gooseberries, hawthorns must be cleaned of sharp thorns so that the animal does not injure the oral cavity.
  • Twigs (about 1 cm in diameter) are divided into parts 5-7 cm long. This size is convenient for a chinchilla that eats while sitting and holding a treat in its front paws.
  • The chopped twigs are washed well and poured over with boiling water. Dry in the oven, placing on a baking sheet in a thin layer.
  • The oven door is left slightly open. Check and mix the sticks periodically.
  • Completely dried branches are stored in cardboard boxes. Plastic containers are not suitable for this, they can become moldy there. Well dried wood will not grow moldy. However, after a few weeks, you need to check the twigs. those infected with mold are thrown away, the rest are dried.

Branches of which trees can be given to chinchillas, how much and why

On the rocks, where chinchillas live in the wild, vegetation is rather sparse. However, the diet of rodents is diverse: cereals, legumes, lichens, cacti, and necessarily shrub branches and tree bark.

When breeding animals at home, in addition to vegetables, fruits and hay, you need to give chinchillas twigs. Rodent food will be complete when young shoots and greens are added to the food in the summer and dried branches in winter.

But first you need to find out which trees and shrubs are suitable for food for the animal, as well as how to provide it with this food in the winter.

What branches to give chinchillas

Wood dressing is no more than a quarter of the daily diet. Depending on the type of harvested stocks, dried branches can be given to a chinchilla in about the following amount:

  • gooseberries. up to 3 twigs for 7 days;
  • rowan, hawthorn and sea buckthorn, 1-2 branches per week are enough;
  • Kalina is given 2 pieces per week;
  • raspberries and willow are offered 1 twig every 2 weeks;
  • birch is loved by many chinchillas. In addition to vitamins and microelements, birch leaves and branches contain phytoncides with antimicrobial action, which is especially useful for young growth. The foliage contains a lot of ascorbic acid and substances that activate metabolic processes. Feed your pet 1 branch weekly;
  • an elm is offered as an escape every 3 days;
  • chinchillas eat willow and pear well. Within a week, you can give up to 5-6 shoots. The most nutritious sprouts are cut during the colder months;
  • currant branches are useful for chinchilla, 3 twigs are distributed for a week;
  • linden can be put into the cage in any quantity;
  • offer a slice of hazel twice a week;
  • aspen (bark and branches) is given every 3-4 days. The best time to harvest is winter.
  • oak and alder will help with diarrhea. It is enough to divide one twig into 7 parts and give for a week to normalize the intestines and not cause constipation.

Some owners harvest pieces of grapevine, rosehip sprouts, apple trees.

Some feed manufacturers add carob fruit to some species. They are rich in proteins, sugars, pectins, B vitamins, iron, magnesium, potassium, calcium and other elements.

Harmful branches for chinchillas

Some plants not only will not benefit rodents, but are strictly forbidden to them:

  • any coniferous trees and plants whose wood contains resin;
  • cherry, almond, plum, apricot and other pitted fruit trees. From the cyanide compounds present in them, hydrocyanic acid (the strongest poison) is formed;
  • all citrus fruits;
  • buckthorn, lilac, elderberry, maple, bird cherry.

Accustom the animal to woody food gradually, observing the reaction to a new delicacy for several days. Not all animals eat the branches of different plants with the same pleasure. Over time, you will understand your pet’s preferences and will be able to stock up on what he liked.

What twigs can be given to chinchillas

Shrubs and trees can not be offered to chinchillas all the time. Depending on which branches and twigs are available in abundance, the diet should be planned as follows:

  • Hawthorn. before feeding, you should remove the leaves and thorns, give 1-2 branches a week;
  • Kalina. 2 pieces every 7 days;
  • Gooseberries. 3 branches per week, previously cleaned of thorns;
  • Raspberries. also clean off anything that can harm the animal, it is supposed to have 1 twig every 2 weeks;
  • Sea buckthorn. remove leaves, give on a twig 1-2 times a week;
  • Rowan. the method is similar to sea buckthorn;
  • Currants. it is supposed to distribute 3 pieces for a weekly diet;
  • Mulberry. you can pamper your pet once a week with 1 thing;
  • Alder. effective for diarrhea, if you feed the animal 1 twigs every 7 days;
  • Birch. the scheme of reception is similar to alder;
  • Willow. it is not recommended to exceed the dose of 1 twig for 2 weeks;
  • Elm. shoot every 3 days;
  • Pear. it is allowed to give 2 branches up to 3 times a week;
  • Willow. can be given at the same frequency as a pear;
  • Linden. can be kept in a cage at all times;
  • Hazel. twig twice a week;
  • Aspen. 1 rod 2-3 times a week.

You need to know which branches and in what form to give to the chinchilla

Which tree branches can be given to chinchillas

The diet of rodents should be varied, so it is necessary to add greens and young shoots to it. However, before filling the feeder, you should figure out which branches can be given to the chinchilla. Not every tree or shrub will have a beneficial effect on your pet.

Rules for the procurement of raw materials

The need to introduce various shoots and twigs into the diet of rodents is explained by several factors:

  • saturation of the pet’s body with vitamins and minerals;
  • improvement of the dental system;
  • positive influence on the behavioral factor. chinchillas use branches as toys.

Features of harvesting green food at home:

  • collection of branches is possible only in ecologically clean areas, far from highways, densely populated areas, industrial enterprises;
  • the optimal time for collecting wood and foliage is the growing season;
  • it is necessary to make sure that there are no moldy parts, lichens, traces of pests and fungus;
  • at home, each rod must be sequentially rinsed with hot and cold water, dried;
  • store in a place with minimal moisture content;
  • the bark should be left on the twigs. it is it that contains the maximum concentration of nutrients.

Harmful branches for chinchillas

Veterinarians and zoologists have identified many plant species that can be fed to rodents to improve health. However, there are varieties that chinchillas are absolutely not allowed. Among them:

  • all varieties of conifers;
  • citrus trees;
  • apricot, plum, cherry;
  • any kind of tree with resinous wood;
  • lilac, buckthorn;
  • bird cherry, elderberry, maple.

Knowing exactly what chinchillas eat, you can independently prepare for them a varied green menu and often the pet’s joy with a new delicacy that will only benefit.

What trees can a chinchilla

To keep your pet in good health, you must first take care of the diet. Each owner should know which branches can be given to chinchillas and which ones cannot be given.

Why does a chinchilla need twigs in its diet? There are several reasons for this:

  • Thus, the rodent’s body can receive minerals, as well as nutrients necessary for the development of the body and health;
  • Twigs help to improve the condition of the pet’s teeth;
  • Using twigs as toys is one of the chinchilla’s entertainments.

If you want to know what branches can be given to a chinchilla, then you should know the following:

  • You can only collect twigs for your pet yourself in places that are environmentally friendly. You can’t pick twigs by the road, but a forest may come up;
  • It is best to organize the collection of twigs for a pet during the so-called growing season;
  • It is imperative to make sure that there are no fungi, various kinds of parasites on the windmills you have collected;
  • At home, after collecting the branches, it is necessary to rinse them well under hot and cold water, and then dry them thoroughly;
  • It is necessary to keep the branches for chinchilla collected by you in those places where there is a low moisture indicator;
  • The bark on the branches contains a large amount of substances useful for the animal, so it should be left.
READ  How often can you give your dog bones?

These tips should be followed by every owner of a small fluffy animal.

What twigs can chinchillas

  • Kalina. twigs of this shrub for chinchilla can be given 2 pieces once a week;
  • Hawthorn. branches of this shrub are given to a fluffy animal one or two pieces per week.

Please note that the branches must be processed first: remove all thorns from them, as well as leaves;
Gooseberries. twigs of this shrub can be given to pets three pieces per week.

In advance, it is necessary to remove all thorns on them from the branches;
Sea buckthorn. for chinchillas, give one twig once or twice every seven days.

The leaves on the branches are removed in advance;

  • Mulberry. chinchillas, as a rule, are given one branch for feeding every seven days;
  • Willow. a branch of this tree for a chinchilla is given once in an amount of one piece every fourteen days;
  • Hazel. it is recommended to give your pet one twig twice a week.
  • chinchillas (based on the forum)

    Everything should be given only dried! Fresh fruits and leaves cause diarrhea in chinchillas (at best). Some owners give their pets jerky snacks. But I am not a supporter of this. One chinchilla will react to this normally, while the other will be bad. So it’s best not to risk it.

    If the leaf is dried correctly, then all vitamins are preserved in it. Let me note right away: do not give everything at once! Give no more than two sweets a day (for example, a leaf and berries), and if you have a few of them, then one a day (so that the same sweets are not repeated more than twice a week, and if possible, it is better to repeat even less often ).

    Think of sweets as candy and chinchillas as children. Don’t spoil them! It is best to make a schedule. Be prepared for begging.

    Don’t give in! You can buy ready-made dried leaves and berries (some chinchilla owners collect them not only for themselves, but also for sale; you can also buy something at the pharmacy (however, the foliage there is too small) and something from herbalists). You can collect them yourself.

    To do this, you should remember the following rules:. it must grow in an ecologically clean area (you cannot collect it in the city and near the road);. after harvesting, the plant must be washed and put to dry;. it should be dried not in the sun, but in the shade (then all vitamins will be preserved), on a rag or paper;. when drying, everything should be laid out so that it does not overflow; if mold appears or rot, then the plant should simply be thrown away. In the matter of taming a chinchilla to the owner, sweets are the best helpers. But remember. don’t overuse! Let me also remind you that these are rodents, so they constantly need to gnaw something. They love to gnaw all kinds of twigs. Twigs can be given to them every day, or as they gnaw (whichever is faster). They can be easily dried by yourself, or purchased from other breeders. The rules for picking twigs are the same as for herbs. In winter, twigs can be dried under a battery.

    IMPORTANT! If the chinchilla begins to be mischievous with food, but the issuance of snacks and twigs should be reduced, or even stopped altogether. Only if the chinchilla eats granulate well, it can be pampered with sweets.

    Each new tasty treat or twig should be introduced into the chinchilla’s diet gradually (with very small portions (for example, one viburnum berry), while monitoring the gastrointestinal tract reactions. In case of constipation or diarrhea, you should immediately exclude it from the diet. if you give something for the first time, then you should not interfere with it with something else, otherwise you will not understand what exactly such a reaction is from.

    Berries: Lingonberry berries Blueberries berries Cranberries Black currants berries Red currants Berries of red mountain ash Berries of black mountain ash Berries of rose hips Hawthorn berries Raspberries

    Lingonberry leaves Currant leaves Plantain leaves (possible with inflorescences) Strawberry leaves Birch leaves Mother and stepmother leaves Raspberry leaves Parsley leaves Hazel leaves Dandelion leaves Flowers: Calendula flowers Linden flowers Chamomile flowers Clover flowers Cornflowers hawthorn flowers

    Tea rose flowers (PLEASE SPECIFY WHETHER ANY ROSE IS POSSIBLE TO GIVE, EXCEPT THE STORE, that is, we are talking only about roses grown in clean areas, without the use of chemicals.)

    Dandelion flowers (PLEASE CORRECT IF IT CANNOT. I have never tried it myself) Roots Jerusalem artichoke Dandelion root Dried carrot Calamus root Parsley root Eleutherococcus root Ginseng root Burdock root

    Nettle Mint Melissa Highlander Oregano Echinacea Thyme Alfalfa Malva Rump Clover Milk thistle seeds (for the liver) Flax seeds (for wool, against inflammation and constipation) Alder cones (an easy remedy for softening boluses. There is no resin in them, these other cones are not coniferous.) grinder pepper Apple Pear Hibiscus Pumpkin seeds (no more than 1 per week, prevention of worms) All this should be given in small quantities. If these are small leaves, then 2-3 leaves, if these are small berries, then 3-4 pieces, large berries 1-2 pieces each, large fruits (apples, pears, carrots, etc.) on a wedge.

    Among it is also impossible: Raisins (only ONE little thing to a female after a difficult birth is possible) Banana Nuts Sunflower seeds Honey Stone fruits (cherries, dried apricots, prunes) Figs Persimmon, etc.

    Quince Bamboo Birch (but in small quantities) Hawthorn (cut off the needles with a knife) Beech (controversial option: Vera on 28.08 wrote that Polish breeders recommended it to her, because it serves for a long time due to hard wood; however, initially it was attributed to list of poisonous) Willow (in case someone does not attribute it to Willow) Grapevine Elm Pear Gum Walnut Wild apple tree Blackberry Yeshta (hybrid of currant and gooseberry, without thorns) Strawberry tree Willow (not White willow) Kalina Dogwood White maple Red currant Linden Magnolia Raspberry (cut off the needles with a knife) Sea buckthorn (cut off the needles with a knife) Alder (many accessories in cages are made from them) Walnut Aspen Rowan Pine (only dried to an almost white (very light) color, often used as a material for shelves) Bearberry Poplar Black currant Cholla Mulberry Rosehip (cut the needles with a knife) Apple tree Ash

    Poisonous wood species unsuitable for chinchillas:

    All stone fruits and conifers (many will be mentioned later) Apricot Anacardia Western White Acacia Elderberry Beech (controversial option: Vera on 28.08 wrote that Polish breeders recommended it to her, because it serves for a long time due to hard wood) Ginkgo cherry (Chinese) sweet Hydrangea (tree) Dalbergia blackwood Mahogany wood Walnut wood Teak wood Citrus wood: lemon, orange, grapefruit, etc. Ebony (black) wood Oak (the bark is suitable for treating diarrhea, but in a healthy animal it causes constipation) Spruce Chestnut Cedar Cypress Maple (unknown) Ash-leaved maple Buckthorn Laurel noble Mango tree Melia Iranian Mesquite tree Almond Myrtle Juniper tree Nectarine Octarine Spruce Weeping fig Sandalwood Sequoia Plum Pine (fresh, pressurized, reddish tint) Pine cones Yew Tsuga (American coniferous tree) Pistachio tree Black lotus Eucalyptus

    The list is fully compiled on the basis of the forum materials. Honestly, I don’t remember what was copied from anyone, so if someone is unhappy that I didn’t indicate his name, contact me. I will definitely correct it.

    (Most of the herbs are copied from the position of “Merry afternoon snack” Alexey has added a little; the list of trees has already been repeated several times on the forum, so I don’t even know who compiled it, plus made some additions to it)

    Chamomile, mint, lingonberry, dandelion (roots and leaves), plantain, coltsfoot, strawberries (and leaves and fruits), burdock (roots and leaves), nettle, alfalfa, mallow, vetch, calendula, Ivan tea, mint, lemon balm, bird highlander, hibiscus, rose petals (not purchased), birch, raspberry, hazel, currant, apple, etc.

    Also, in the diet of chinchillas, branches of deciduous trees must be present. They help grind down your ever-growing teeth, and their bark contains many vitamins and minerals. It is advisable to give the animal a small stick per day.

    Here is a list of trees and shrubs, branches of which can be offered to Chinchilla: apple raspberry (without thorns) birch linden maple willow (willow willow) alder rowan hawthorn elder ash elm currant

    • It is not recommended to give branches below the listed trees:

    To avoid calcium and vitamin C deficiency, chinchillas are given a calcium gluconate tablet once a week and half an ascorutin tablet.

    Water chinchillas should be changed daily to prevent the growth of algae and bacteria. In this case, you need to use bottled water or water passed through a filter (since boiled water does not contain the necessary minerals)

    There are about six types of twigs stored in my bins. I really want to treat the fluffy with all the permitted types of trees, but Tony does not agree with me and he does not need so much. He loves to eat the usual twigs more, he quickly gets bored with everything new. My little conservative.

    Like willow sticks, in my set, almost all of the branches were large enough, but this does not prevent the chinche from eating them. For better convenience, I tied the branches together and tied them to the shelf of the display case.

    Manufacturing company: Little One, Russia, St. Petersburg

    Description: Rodents and rabbits have teeth that grow all their lives. For this reason, animals must constantly grind them down. The inability to grind teeth leads to various adverse consequences: dental diseases, gum wounds, etc.

    Little One Hazel Branches are a natural toothbrush for rodents and rabbits. The gnawing of hazel or hazel branches guarantees daily dental care of animals, while providing activities for pets for a long time.

    Texture: well dried. The bark does not crumble, does not flake off. The texture inside the branch is dense. The chinchilla gnaws them better than willow sticks, but still reluctantly and for a long time.

    No artificial colors or preservatives.

    Color: brown, like milk chocolate. The core is of the usual wood color. Odor: subtle coffee, slightly sweetish and very pleasant

    Pet’s Reaction Tony presses the twig to the floor with both paws and only then gnaws. She eats with pleasure, especially recently. Loves more than willows. Due to their large size, they are not suitable for babies.

    The twigs will last even longer if you alternate the twigs. For my chinchilla, I always leave in full access several types of branches of different hardness:

    READ  A cat cannot give birth for a day what to do

    Packing: a dense plastic bag filled entirely. Above is a cardboard clip-label, fastened with staples. There was no garbage in the package.

    Idea: I made a bridge from some of these branches and tied it to the shelf so that the chincha would often walk with its paws on the rough surface. It is better to tie them together with a thin line, later I replaced the twine in the photo.

    The twigs are conveniently packaged ⏤ a large plastic bag in which they can be stored. But I prefer to pull out all the branches and secure with a transparent rubber band to save space and less noise. I recommend it for purchase and will take more.

    Tree leaves for chinchillas, herbs

    Among the tree species, various parts of which can be fed to chinchillas, the following can be distinguished.

    Birch. Its leaves and branches are rich in vitamins and sugars. They contain a lot of phytoncides, substances with antimicrobial properties. Captive bred animals are usually in short supply, especially young animals.

    Young birch leaves contain a lot of ascorbic acid (vitamin C), and the buds contain vegetable fats and other valuable substances.

    The leaves were found to contain substances that stimulate the vital processes of animal organisms, similar in composition to those of ginseng. Birch branches collected in summer and winter, as well as leaves, can be fed to chinchillas throughout the year.

    Oak. Acorns and oak branches attract the attention of chinchillas all year round. They are very nutritious. In addition, they are useful for indigestion in animals (diarrhea). they contain tannins. But in constant and large quantities, it can cause constipation.

    Willow. Various types of willows are a valuable food product readily eaten by chinchillas. Leaves and branches are fed to animals all year round. Most nutritious branches cut during winter.

    Aspen. Aspen leaves, bark and young shoots can serve as an additive to chinchilla feed in all seasons. They need to be harvested in winter, since during this period they contain much more fat and protein.

    Juniper. The needles and berries of this small tree are healthy and attractive food for chinchillas. Berries contain up to 40% sugars, they have bactericidal properties.

    Pine. The needles of this tree contain about 3% fat, up to 20% starch. In addition, it contains a significant amount of iron, an element that is part of the hemoglobin of blood, and special bitter-spicy substances have been found that stimulate appetite in animals.

    Pine needles are known for their high vitamin content. There is especially a lot of vitamin C in needles. ascorbic acid is six times more than in lemons or oranges. The animals are fed primarily with young spring shoots. Chinchilla pine seeds are readily eaten throughout the year.

    Poplar. In terms of nutritional value, poplar leaves are superior to the best forage grasses and are an excellent food. However, chinchillas eat them badly.

    In addition to the above plants, the animals consume leaves, shoots and bark of pear, apple, linden, hazel, blackberry, raspberry, sea buckthorn, etc.

    Branches of apricot, wild rosemary, elderberry, wolf bast (wolfberry), buckthorn, almond, poisonous sumac, bird cherry should not be fed as branch feed, as they contain toxic substances.

    When giving branches of oak and alder, it should be borne in mind that they contain a lot of tannins (tannin), so it is advisable to feed them to animals as a fixative for digestive disorders.

    Large amounts of birch branches can lead to kidney inflammation.

    (SP Bondarenko. “Diseases of fur animals.”) Green food. grass and leaves of trees. should be no more than a quarter of the daily diet of a chinchilla (it is recommended to train 1 blade of grass per day, and preferably in dried form, because it causes digestive disorders, diarrhea).

    Young animals require special attention when feeding.

    Until the cubs reach the age of 1.5 months, it is not recommended to include green and juicy food in their diet, although a piece of green leaf taken from their parents will not harm healthy babies. From the age of six weeks, the cubs begin to eat green food, which is gradually introduced into the diet and the portion is gradually increased.

    Tea. Chinchillas are very fond of dry tea leaves. You can give green tea, black tea, and mate, but always natural, without artificial flavors.

    Remember, too, that tea contains tannins, which are fortifying properties. Therefore, give a serving of tea no more than 1/3 teaspoon no more than three times a week.

    It is good to combine tea leaves and dry petals of the Sudanese rose (“hibiscus”), which have a slight laxative effect.

    Rosehip and wrinkled rose buds. 4-5 pieces; Strawberry and strawberry leaves. several pieces each.

    Rosehip. unlimited peel, and give only the peel, and crush and remove the seeds! There are many cases of trauma to the gums from thorns of seeds! If you notice tears that the chinchilla refuses to eat. most often it is gum inflammation (stomatitis) Treat the gums with Metrogyl denta ointment.

    Blueberries. a few berries a day, because dried berries have fastening properties.

    Dangers to Chinchillas | The DON’Ts of Chinchilla Care

    Raisins. 1 pc. 1 time per week, during the recovery period or for lactating and pregnant females sweet dried fruits are FORBIDDEN in the daily diet! cause insulin shock coma!

    Drying apples. 1p per day. useful vitamin C.

    Chinchillas are very fond of oatmeal, which has a high taste and is source of B vitamins.

    All the chinchillas I know are ready to sell their homeland for rolled oats, but you can only give it 1 teaspoon a day.

    Hercules must be absolutely clean, dry and crumbly, free of foreign inclusions and impurities, free of mold, etc. Even better if it is a mixture of several cereals in the form of flakes.

    Germinated grains of cereal plants.

    Germinated grain is very useful for animals, especially young animals. In winter and early spring, germinated grain can be given at the rate of 10-15% of the daily requirement. For this, oats or barley are poured with water and kept in a warm room for 24 to 48 hours. The swollen and moistened grain is scattered on shelves in a bright room and fed after a few days when sprouts appear.

    Plants only in dried form, preferably except for the roots:

    Cabbage. causes gas formation. Not Carrots. recommended in dried form Dill. questionable, it has a diuretic effect and, in principle, is useless (but many give it for bloating, as it is recommended even for babies).

    pepper. in the same way as cabbage causes gas formation Beets. although healthy, but weakens, so it is also not necessary Cucumbers. harmless, but not every animal will eat this actually water vegetable Bananas. too sweet, not recommended Pears. if moderately sweet, then dried ( grafted. cause diarrhea) Grapes, raisins. och sweet, but a giving birth to a female or a sick animal can be given a raisin Sunflower seeds and nuts are a killer for the liver. Do not get carried away with dried apricots and prunes. they are sweet and very weak. Better give dried apples. Persimmon. contains a lot of iodine. Since in the treatment of rodents they try to avoid iodine-containing preparations, it is better not to give. It is also sweet and has astringent properties, it can be constipated Tea rose petals. you can, but only grown with your own hands. Store-bought ones cannot be given, because they are processed with a bunch of chemicals.

    As a delicacy, you can give: dried carrots and apples (a small dried slice), Rosehips, hawthorns, alfalfa rings, without yeast loaves (also a small piece), occasionally 1 raisin (for a pregnant and lactating female), 1 pumpkin seed (prevention of worms ),

    Dried herb: Nettle leaf, Dandelion, Plantain, Clover, Alfalfa

    Dry twigs / leaves: apple, pear, currant, mountain ash, raspberry

    • The branches of trees are recommended, the fruits of which are without pits, for example: apple, birch, willow, etc. The branches are ideal both for treats and for grinding teeth (it must be constantly in the cage)
    • List of poisonous wood species not suitable for chinchillas

    mindalabrikosbukbelaya akatsiyachorny lotosdalbergiya chernodrevesnayaklon yasenelistnyykrushinaanakardiya zapadnayakedrvishnyakashtanmeliya iranskayadrevesina citrus: lemon, orange, grapefruit and t.p.kiparisdrevesina ebony (black) derevabuzinaevkaliptpihta, elginkgo (Chinese) hemlock (American conifer) padubgledichiya sladkayagortenziya (Tree) mozhzhevelniklavr blagorodnyydrevesina red derevamangovoe derevoklonmeskitovoe derevomirtnektarindub (suitable for treatment of diarrhea, but for a healthy animal. causes constipation) oleander peach tree pine. fresh, treated only by pressure, reddish shade pine cones pistachio trees plums sandalwood sequoias teak wood walnut wood weeping fig

    Branches of stone fruit trees should not be allowed to chinchillas under any circumstances.

    the toxicologist writes that you cannot give branches, seeds, leaves, bark of trees belonging to the genus Prunus: cherries, sweet cherries, plums, apricots, peaches, nectarines.

    They contain the glycoside amygdalin (a cyanide compound), the cleavage product of which in the body is hydrocyanic acid. There are many recorded cases of fatal poisoning.

    On the other hand, there is information that the bark itself is dangerous in the branches of the same cherry, and the juice in the cambium (the layer immediately behind the bark), which contains all the toxic elements

    What branches can you give a chinchilla to gnaw

    In the daily diet of chinchillas, it is necessary to include branches, twigs, driftwood, pieces of wood of various types of trees and shrubs. This is done not only in order to diversify the diet of animals and supplement it with natural vitamins and microelements, but also in connection with the peculiarity of the structure of the chinchilla’s dental system. The pieces of wood also serve as toys that positively influence animal behavior and prevent bad habits (such as gnawing on fur).

    Dried branches in their properties (nutritional value) are close to medium-quality meadow hay.

    From woody foods, chinchillas prefer to eat shoots, leaves and bark:

  • hazel, apple, acacia, willow.
  • raspberries, lindens, rose hips, hibiscus, willow.
  • You can also include branches and leaves in the diet of animals:

  • rowan, pear, birch, black currant, sea buckthorn.
  • hawthorn, chestnut, hazel, alder.
  • Greenery is rich in vitamins, contains proteins (8-15%), fats (5-8%), fiber, nitrogen-free extractive substances, microelements. On an industrial scale, vitamin flour is obtained from woody greens.

    Branches of trees and shrubs should not be cut in cities, parks, along roads and highways. They should be harvested during the growing season, in ecologically favorable areas.

    The branches should be free of mold, lichens, traces of fungal infection, pests. The branches should be rinsed under hot water and dried well. Do not free the bark from the trunk. It is the bark that is the main source of nutritional value for wood fodder.

    Wood species harmful or poisonous to chinchillas:

    • conifers, citrus;
    • plum, cherry, apricot and others with resinous wood;
    • wild rosemary, wolf bast, buckthorn, lilac, elderberry, bird cherry, maple.

    Full or partial copying and posting of information from the site is prohibited.

    What branches can you give a chinchilla to gnaw

    What branches and leaves can be given to a chinchilla, how to process them

    READ  Yorkshire terrier ears when standing in puppies

    Chinchilla is a representative of rodents, which requires a varied diet, including legumes, cacti, cereals, leaves, branches and bark, because it is with them that the animal relishes in the wild. At home, the animal needs to be provided with no less variety, and, in addition to hay and grain, bark and branches should be given to it. However, before that, it is important to find out which parts of trees, as well as shrubs, are suitable for feeding the rodent in order to avoid causing harm.

    The benefits of wood for the body of chinchillas

    Chinchillas should be allowed to eat bark and twigs for several reasons.

    Among them are the following:

    • The teeth of an animal, like any other rodent, are constantly growing. Therefore, he needs to regularly chew on something to grind. Hardwood is one of the best choices. If you restrict the animal in the branches, it will gnaw what it finds, and not in all cases the owner will be happy about this.
    • Wood. its use is an excellent opportunity to make the diet of a pet, which, when living in a cage, is significantly limited in choice, more diverse.
    • The branches are rich in minerals, vitamins and other useful elements that are important for the full growth and life of pets. Fats, proteins and fiber are also present in large quantities. It is also a great addition to your pet’s daily diet. In terms of usefulness, the product is equated to hay. Industrial analogue. vitamin flour, which is made from the same raw materials.

    The chinchilla also perceives wooden objects as toys. With the help of twigs or twigs, it is possible to easily captivate the pet with games. Communication in this way will brighten up the gray everyday life of both the pet and its owner. A favorite will become more active and communicative, learn to trust a person.

    Features of collecting and harvesting branches

    The harvesting of twigs begins during the growing season of the trees. The reason is simple. the sap formed in the trees at this time is the most nutritious and valuable in composition. The signal for their collection is the appearance of kidneys. It is important to give preference to environmentally friendly places for cutting twigs. You should not choose for harvesting wood near highways, and even more so in industrial-type regions. Finding really clean branches in urban areas is also problematic.

    During the collection and harvesting of branches, it is worth adhering to the following recommendations:

    • The bark is represented by an impressive m of nutritional components, so there is no need to peel it off.
    • When cutting stems with thorns (for example, in raspberries, hawthorns, gooseberries), you need to get rid of sharp thorns in order to eliminate the likelihood of injury to the animal’s oral cavity.
    • The optimal choice is branches with a diameter of about 1 cm and a length of 5-7 cm each. It is these rods that are considered convenient for rodents that eat the treat, holding it in the front legs.
    • After cutting, the branches must be washed under running water, and then they are additionally doused with boiling water.
    • You can dry the twigs in a natural way. under the sun in a suspended or unfolded state. An alternative and faster option is to use the oven at 150 ° C. In this case, the branches are stirred from time to time, and the oven door is slightly opened. The total time varies from the number of rods and can average from 2 to 5 hours.
    • Completely dry branches are removed for storage. For this, cardboard boxes or paper bags are suitable. Polyethylene, film or plastic containers are not used for these purposes, because the rods in them can become moldy.
    • Every 2-4 weeks, the branches are sorted out, checking for mold. If it does appear, discard the infected twigs, and rinse the rest again and dry in the oven again.
    • Mostly branches are introduced into the diet in a dry or semi-dry form. Sometimes fresh are also allowed, but if possible it is better to refuse them so as not to harm the animal.

    How to make a blank

    Branches for chinchillas are harvested at the time of the growing season of trees. During the time when they contain the most useful substances. Areas for collecting branches should be chosen with a favorable ecological situation.

    Do not cut branches of trees located in city parks, near industrial enterprises and highways.

    The branches should be free of mold, as well as pests, lichen and fungal infections.

    Branches are cut with a pruner at a time when buds have appeared on the trees, but the leaves have not yet begun to bloom. The juice that moves along the trunks during this period has the most nutritious composition.

    • The branches for feeding chinchillas should only be alive. Dried, contaminated, and with traces of mold are not suitable for the animal. If these are raspberry stalks, they should not be covered with sharp thorns, otherwise the animal may injure the oral cavity.
    • The branches are cut into pieces of 5. 6 cm (it is more convenient to use not too thick ones: about 1 cm in diameter). If the sticks are more massive, the animal will gnaw only the bark from them, and the thin ones will eat them whole.
    • The chopped branches are washed well and poured over with boiling water. Then they are placed on a baking sheet in a small layer and placed in the oven for drying.
    • The time it takes for the twigs to dry completely will depend on the type of oven. If we are talking about a gas stove, at a temperature of 200C, they will reach the required state in 90 minutes. In this case, the door should not be completely closed. Stir the sticks every 30 minutes and check that they do not become charred.
    • When the chinchilla twigs are completely dry, they are placed in a cardboard box (they can get moldy in a plastic container). If they are dry to the required degree, they should not grow moldy. But still, within 7. 10 days you need to check their condition. When mold appears, the infected branches are thrown away, and the remaining ones are dried.

    Why chinchilla twigs

    Wood helps the rodent to diversify its food. It is needed as a supplement, thanks to which the animal receives vitamins and minerals.

    With the help of hard wood, the chinchilla successfully grinds off its teeth, which must be done constantly.

    Branches and wooden objects also function as toys for the animal. If the pet will not be distracted by various games, it may begin to gnaw its fur.

    In terms of nutritional value, dry twigs are close to natural hay with relatively good quality. They contain up to 8. 15% proteins, various types of fats (5. 8%), as well as a large amount of fiber and other components. In industry, such raw materials are used to obtain vitamin flour.

    What branches can be given to a chinchilla

    Rodents prefer fresh growth and bark of older trees:

    • apple trees,
    • hazel,
    • and you,
    • willows,
    • hibiscus,
    • rose hips,
    • raspberries,
    • linden trees.

    Also, chinchilla’s favorite food are branches with leaves of rowan, birch, alder, pear, poplar, black currant, hawthorn, sea buckthorn, hazel, dogwood, elm, grapes, aspen, quince, blackberry, aspen, viburnum.

    Formulating a Chinchilla Diet

    The twigs need to be dried well. this is very important.

    It is not necessary to remove the entire bark: thanks to it, rodents can receive everything they need for the proper functioning of the body.

    The following scheme will help to correctly distribute the number of branches of different types of plants:

    • birch. 1 twig per week (means of preventing diarrhea);
    • hawthorn. 1. 2 branches (peeled of leaves and thorns) per week;
    • pussy willow. 1 piece of branch in 10. 15 days. (not more often);
    • elm. 1 shoot in 3 days;
    • pear. 2 twigs 3 times a week;
    • willow. 2 twigs three times every 7 days;
    • Kalina. 2 shoots 1 time in 7 days;
    • gooseberry. 3 twigs per week (no thorns);
    • hazel. 1 branch twice every 7 days;
    • linden. unlimited (can always be near the rodent);
    • raspberries. 1 branch at 12-14 days (without thorns);
    • sea ​​buckthorn. 1 branch up to 2 times every 7 days (without leaves);
    • alder. 1 twig every 7 days. (help in case of diarrhea);
    • aspen. 1 branch within 2. 3 times within 7 days;
    • mountain ash. 1 twig 1. 2 times during the week (the fox is removed);
    • currants. 3 twigs per week;
    • mulberry. 1 twig for 7 days.

    This wood can be used to make toys and furniture for chinchillas.

    What trees can chinchillas gnaw

    Chinchilla nutrition should consist not only of vegetables, fruits, grains, etc. It is necessary that the pet gets along with food the substances necessary for the body, which are contained in various twigs, twigs and snags. But not every tree is suitable for the normal development of a rodent, and before you put any twigs in a cage to it, you need to figure out which trees chinchillas can gnaw so as not to harm the animal.

    What wood is dangerous for chinchilla

    There are many recommendations on which trees can be gnawed by chinchillas, but there are also types of trees and shrubs, the branches of which should absolutely not be given to the animal. These include:

    • citrus plants (branches, trunks, leaves);
    • pine, spruce, fir and other conifers;
    • any wood containing resin;
    • branches and trunks of elderberry, maple, chestnut, acacia;
    • branches, bark and bones of cherry, sweet cherry, plum, apricot, peach (when splitting, they form toxic substances that are dangerous to the life of a rodent).

    The branches of wild rosemary, elderberry, buckthorn, almond, wolfberry, bird cherry also pose a threat to the animal due to increased toxicity. Therefore, they need to be excluded from the pet’s diet.

    The uncontrolled use of twigs that are quite “edible” for chinchilla tree species can also end sadly. For example, if a pet uses birch branches more often than it should, this can lead to inflammation of the animal’s kidneys.

    Building material such as chipboard and plywood should not be given to a chinchilla. In the manufacture of these materials, toxic glue with m of phenol is used. And if they are used to make a house for an animal, their ends are necessarily covered with metal corners to hide them from the teeth of a rodent.

    Oak and alder contain tannins (tannin), and it would be more justified to feed them to an animal with indigestion.

    Wood pulp is an important part of the rodent diet. And if you know which tree branches can be given to chinchillas, you can provide the pet’s body with all the substances it needs.

    FUNDAYUNA.COM 2021